![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) ![]() |
![]() | Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins) |
![]() | Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [81612] (9 PDB entries) |
![]() | Domain d1l2da2: 1l2d A:2-134 [75921] Other proteins in same PDB: d1l2da1, d1l2da3 DNA estranged guanine mismatch recognition complex complexed with hpd, zn |
PDB Entry: 1l2d (more details), 2 Å
SCOP Domain Sequences for d1l2da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2da2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya keeadrrpplael
Timeline for d1l2da2: