Class g: Small proteins [56992] (66 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (2 proteins) |
Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81613] (5 PDB entries) |
Domain d1l2ca3: 1l2c A:235-274 [75919] Other proteins in same PDB: d1l2ca1, d1l2ca2 DNA estranged thymine mismatch recognition complex complexed with hpd, zn |
PDB Entry: 1l2c (more details), 2.2 Å
SCOP Domain Sequences for d1l2ca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2ca3 g.39.1.8 (A:235-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus} fqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d1l2ca3: