Class g: Small proteins [56992] (90 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81613] (9 PDB entries) |
Domain d1l2ba3: 1l2b A:233-274 [75916] Other proteins in same PDB: d1l2ba1, d1l2ba2 DNA end-product structure complexed with ad2, zn |
PDB Entry: 1l2b (more details), 2.4 Å
SCOP Domain Sequences for d1l2ba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2ba3 g.39.1.8 (A:233-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} gtfqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d1l2ba3: