Lineage for d1l2ba3 (1l2b A:233-274)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429921Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 429922Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families) (S)
  5. 430087Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (2 proteins)
  6. 430088Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 430089Species Bacillus stearothermophilus [TaxId:1422] [81613] (7 PDB entries)
  8. 430096Domain d1l2ba3: 1l2b A:233-274 [75916]
    Other proteins in same PDB: d1l2ba1, d1l2ba2
    DNA end-product structure
    complexed with ad2, zn

Details for d1l2ba3

PDB Entry: 1l2b (more details), 2.4 Å

PDB Description: MutM (Fpg) DNA End-Product Structure

SCOP Domain Sequences for d1l2ba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ba3 g.39.1.8 (A:233-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus}
gtfqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr

SCOP Domain Coordinates for d1l2ba3:

Click to download the PDB-style file with coordinates for d1l2ba3.
(The format of our PDB-style files is described here.)

Timeline for d1l2ba3: