Lineage for d1l2ba2 (1l2b A:2-134)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472160Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 472161Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 472162Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 472163Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 472164Species Bacillus stearothermophilus [TaxId:1422] [81612] (7 PDB entries)
  8. 472171Domain d1l2ba2: 1l2b A:2-134 [75915]
    Other proteins in same PDB: d1l2ba1, d1l2ba3
    DNA end-product structure

Details for d1l2ba2

PDB Entry: 1l2b (more details), 2.4 Å

PDB Description: MutM (Fpg) DNA End-Product Structure

SCOP Domain Sequences for d1l2ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ba2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

SCOP Domain Coordinates for d1l2ba2:

Click to download the PDB-style file with coordinates for d1l2ba2.
(The format of our PDB-style files is described here.)

Timeline for d1l2ba2: