Class b: All beta proteins [48724] (144 folds) |
Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) |
Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins) |
Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81612] (7 PDB entries) |
Domain d1l2ba2: 1l2b A:2-134 [75915] Other proteins in same PDB: d1l2ba1, d1l2ba3 DNA end-product structure |
PDB Entry: 1l2b (more details), 2.4 Å
SCOP Domain Sequences for d1l2ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2ba2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus} pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya keeadrrpplael
Timeline for d1l2ba2: