SCOPe 2.06: Domain d1l2ba1: 1l2b A:135-223

Lineage for d1l2ba1 (1l2b A:135-223)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (4 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein DNA repair protein MutM (Fpg) [81620] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries)

8. Domain d1l2ba1: 1l2b A:135-223 [75914]
   Other proteins in same PDB: d1l2ba2, d1l2ba3
   DNA end-product structure
   protein/DNA complex; complexed with zn

Details for d1l2ba1

PDB Entry: 1l2b, 2.4 Å

PDB Description: MutM (Fpg) DNA End-Product Structure

PDB Compounds: (A:) MutM

SCOPe Domain Sequences for d1l2ba1:

Sequence; same for both SEQRES and ATOM records:

>d1l2ba1 a.156.1.2 (A:135-223) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstvr

Timeline for d1l2ba1:

• d1l2ba1 first appeared in SCOP 1.63
  
• d1l2ba1 appears in SCOPe 2.05
  
• d1l2ba1 appears in SCOPe 2.07
  
• d1l2ba1 appears in the current release, SCOPe 2.08