Class a: All alpha proteins [46456] (286 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries) |
Domain d1l2ba1: 1l2b A:135-223 [75914] Other proteins in same PDB: d1l2ba2, d1l2ba3 DNA end-product structure protein/DNA complex; complexed with zn |
PDB Entry: 1l2b (more details), 2.4 Å
SCOPe Domain Sequences for d1l2ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2ba1 a.156.1.2 (A:135-223) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas lsskeierlheemvatigeavmkggstvr
Timeline for d1l2ba1: