Lineage for d1l2ba1 (1l2b A:135-223)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650278Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 650279Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 650319Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 650320Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 650321Species Bacillus stearothermophilus [TaxId:1422] [81611] (9 PDB entries)
  8. 650329Domain d1l2ba1: 1l2b A:135-223 [75914]
    Other proteins in same PDB: d1l2ba2, d1l2ba3
    DNA end-product structure
    complexed with ad2, zn

Details for d1l2ba1

PDB Entry: 1l2b (more details), 2.4 Å

PDB Description: MutM (Fpg) DNA End-Product Structure
PDB Compounds: (A:) MutM

SCOP Domain Sequences for d1l2ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ba1 a.156.1.2 (A:135-223) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstvr

SCOP Domain Coordinates for d1l2ba1:

Click to download the PDB-style file with coordinates for d1l2ba1.
(The format of our PDB-style files is described here.)

Timeline for d1l2ba1: