Lineage for d1l2ba1 (1l2b A:135-223)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218644Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 218645Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 218663Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (2 proteins)
  6. 218664Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 218665Species Bacillus stearothermophilus [TaxId:1422] [81611] (5 PDB entries)
  8. 218670Domain d1l2ba1: 1l2b A:135-223 [75914]
    Other proteins in same PDB: d1l2ba2, d1l2ba3
    DNA end-product structure
    complexed with ad2, zn

Details for d1l2ba1

PDB Entry: 1l2b (more details), 2.4 Å

PDB Description: MutM (Fpg) DNA End-Product Structure

SCOP Domain Sequences for d1l2ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ba1 a.156.1.2 (A:135-223) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus}
gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstvr

SCOP Domain Coordinates for d1l2ba1:

Click to download the PDB-style file with coordinates for d1l2ba1.
(The format of our PDB-style files is described here.)

Timeline for d1l2ba1: