Class g: Small proteins [56992] (61 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (2 proteins) |
Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81613] (5 PDB entries) |
Domain d1l1za3: 1l1z A:233-274 [75913] Other proteins in same PDB: d1l1za1, d1l1za2 covalent-DNA intermediate complexed with ped, zn |
PDB Entry: 1l1z (more details), 1.7 Å
SCOP Domain Sequences for d1l1za3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1za3 g.39.1.8 (A:233-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus} gtfqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d1l1za3: