Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81613] (23 PDB entries) |
Domain d1l1ta3: 1l1t A:235-274 [75910] Other proteins in same PDB: d1l1ta1, d1l1ta2 bound to abasic-site containing DNA protein/DNA complex; complexed with zn |
PDB Entry: 1l1t (more details), 1.8 Å
SCOPe Domain Sequences for d1l1ta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1ta3 g.39.1.8 (A:235-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} fqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d1l1ta3: