Lineage for d1l1ta3 (1l1t A:235-274)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1463401Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1463402Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1463783Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 1463784Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 1463785Species Bacillus stearothermophilus [TaxId:1422] [81613] (9 PDB entries)
  8. 1463788Domain d1l1ta3: 1l1t A:235-274 [75910]
    Other proteins in same PDB: d1l1ta1, d1l1ta2
    bound to abasic-site containing DNA
    protein/DNA complex; complexed with zn

Details for d1l1ta3

PDB Entry: 1l1t (more details), 1.8 Å

PDB Description: MutM (Fpg) Bound to Abasic-Site Containing DNA
PDB Compounds: (A:) MutM

SCOPe Domain Sequences for d1l1ta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ta3 g.39.1.8 (A:235-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
fqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr

SCOPe Domain Coordinates for d1l1ta3:

Click to download the PDB-style file with coordinates for d1l1ta3.
(The format of our PDB-style files is described here.)

Timeline for d1l1ta3: