Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81640] (4 PDB entries) |
Domain d1kyon3: 1kyo N:1-261 [75907] Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc2, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon2, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyou_, d1kyov_, d1kyow_ complexed with fes, hem, m3l, sma |
PDB Entry: 1kyo (more details), 2.97 Å
SCOP Domain Sequences for d1kyon3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyon3 f.21.1.2 (N:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii ftltiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil alfvfyspntlghpdnyipgn
Timeline for d1kyon3:
View in 3D Domains from other chains: (mouse over for more information) d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyou_, d1kyov_, d1kyow_ |