SCOPe 2.04: Domain d1kqfb1: 1kqf B:2-245

Lineage for d1kqfb1 (1kqf B:2-245)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Formate dehydrogenase N, iron-sulfur (beta) subunit [75427] (1 species)

7. Species Escherichia coli [TaxId:562] [75428] (2 PDB entries)

8. Domain d1kqfb1: 1kqf B:2-245 [75900]
   Other proteins in same PDB: d1kqfa1, d1kqfa2, d1kqfb2, d1kqfc_
   complexed with 6mo, cdl, hem, mgd, sf4

Details for d1kqfb1

PDB Entry: 1kqf, 1.6 Å

PDB Description: formate dehydrogenase n from e. coli

PDB Compounds: (B:) formate dehydrogenase, nitrate-inducible, iron-sulfur subunit

SCOPe Domain Sequences for d1kqfb1:

Sequence; same for both SEQRES and ATOM records:

>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]}
ametqdiikrsatnsitppsqvrdykaevaklidvstcigckacqvacsewndirdevgh
cvgvydnpadlsakswtvmrfseteqngklewlirkdgcmhcedpgclkacpsagaiiqy
angivdfqsencigcgyciagcpfniprlnkednrvykctlcvdrvsvgqepacvktcpt
gaihfgtkkemlelaeqrvaklkargyehagvynpegvggthvmyvlhhadqpelyhglp
kdpk

Timeline for d1kqfb1:

• d1kqfb1 first appeared in SCOP 1.63
  
• d1kqfb1 appears in SCOPe 2.03
  
• d1kqfb1 appears in SCOPe 2.05
  
• d1kqfb1 appears in the current release, SCOPe 2.08