![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins) insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243 |
![]() | Protein Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56709] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [56710] (2 PDB entries) |
![]() | Domain d1knyb2: 1kny B:1-125 [75899] Other proteins in same PDB: d1knya1, d1knyb1 complexed with apc, kan, mg |
PDB Entry: 1kny (more details), 2.5 Å
SCOPe Domain Sequences for d1knyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knyb2 d.218.1.1 (B:1-125) Kanamycin nucleotidyltransferase (KNTase), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste eaefshewttgewkvevnfyseeilldyasqvesdwplthgqffsilpiydsggylekvy qtaks
Timeline for d1knyb2: