Lineage for d1kjua4 (1kju A:1-124,A:240-343,A:751-994)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633338Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 2633339Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) (S)
  5. 2633340Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)
  6. 2633341Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 2633342Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (43 PDB entries)
    Uniprot P04191
  8. 2633395Domain d1kjua4: 1kju A:1-124,A:240-343,A:751-994 [75895]
    Other proteins in same PDB: d1kjua1, d1kjua2, d1kjua3
    Structure in the e2 state

Details for d1kjua4

PDB Entry: 1kju (more details), 6 Å

PDB Description: ca2+-atpase in the e2 state
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1a

SCOPe Domain Sequences for d1kjua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjua4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d1kjua4:

Click to download the PDB-style file with coordinates for d1kjua4.
(The format of our PDB-style files is described here.)

Timeline for d1kjua4: