SCOP 1.73: Domain d1kjua4: 1kju A:1-124,A:240-343,A:751-994

Lineage for d1kjua4 (1kju A:1-124,A:240-343,A:751-994)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
   core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains

4. Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family)

5. Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)

6. Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
   the N-terminal 40 residues interact with /form a part of transduction domain A

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (9 PDB entries)

8. Domain d1kjua4: 1kju A:1-124,A:240-343,A:751-994 [75895]
   Other proteins in same PDB: d1kjua1, d1kjua2, d1kjua3
   Structure in the e2 state

Details for d1kjua4

PDB Entry: 1kju, 6 Å

PDB Description: ca2+-atpase in the e2 state

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1a

SCOP Domain Sequences for d1kjua4:

Sequence; same for both SEQRES and ATOM records:

>d1kjua4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

Timeline for d1kjua4:

• d1kjua4 first appeared in SCOP 1.63
  
• d1kjua4 appears in SCOP 1.71
  
• d1kjua4 appears in SCOP 1.75
  
• d1kjua4 appears in the current release, SCOPe 2.08