![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily) core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains |
![]() | Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) ![]() |
![]() | Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein) |
![]() | Protein Calcium ATPase, transmembrane domain M [81663] (1 species) the N-terminal 40 residues interact with /form a part of transduction domain A |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (9 PDB entries) |
![]() | Domain d1kjua4: 1kju A:1-124,A:240-343,A:751-994 [75895] Other proteins in same PDB: d1kjua1, d1kjua2, d1kjua3 Structure in the e2 state |
PDB Entry: 1kju (more details), 6 Å
SCOP Domain Sequences for d1kjua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjua4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg
Timeline for d1kjua4: