Lineage for d1kjua1 (1kju A:125-239)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 678178Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 678179Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 678180Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 678181Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (9 PDB entries)
  8. 678195Domain d1kjua1: 1kju A:125-239 [75892]
    Other proteins in same PDB: d1kjua2, d1kjua3, d1kjua4
    Structure in the e2 state

Details for d1kjua1

PDB Entry: 1kju (more details), 6 Å

PDB Description: ca2+-atpase in the e2 state
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1a

SCOP Domain Sequences for d1kjua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjua1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOP Domain Coordinates for d1kjua1:

Click to download the PDB-style file with coordinates for d1kjua1.
(The format of our PDB-style files is described here.)

Timeline for d1kjua1: