SCOP 1.69: Domain d1kfvb3: 1kfv B:229-271

Lineage for d1kfvb3 (1kfv B:229-271)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families)

5. Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)

6. Protein DNA repair protein MutM (Fpg) [81622] (4 species)

7. Species Lactococcus lactis [TaxId:1358] [81619] (6 PDB entries)

8. Domain d1kfvb3: 1kfv B:229-271 [75891]
   Other proteins in same PDB: d1kfva1, d1kfva2, d1kfvb1, d1kfvb2

Details for d1kfvb3

PDB Entry: 1kfv, 2.55 Å

PDB Description: crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna.

SCOP Domain Sequences for d1kfvb3:

Sequence; same for both SEQRES and ATOM records:

>d1kfvb3 g.39.1.8 (B:229-271) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk

Timeline for d1kfvb3:

• d1kfvb3 first appeared in SCOP 1.63
  
• d1kfvb3 appears in SCOP 1.67
  
• d1kfvb3 appears in SCOP 1.71
  
• d1kfvb3 appears in the current release, SCOPe 2.08