Lineage for d1kfvb2 (1kfv B:1-131)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382622Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 382623Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 382624Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (2 proteins)
  6. 382625Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 382639Species Lactococcus lactis [TaxId:1358] [81617] (2 PDB entries)
  8. 382642Domain d1kfvb2: 1kfv B:1-131 [75890]
    Other proteins in same PDB: d1kfva1, d1kfva3, d1kfvb1, d1kfvb3
    complexed with cry, mse, pdi, zn; mutant

Details for d1kfvb2

PDB Entry: 1kfv (more details), 2.55 Å

PDB Description: crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna.

SCOP Domain Sequences for d1kfvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfvb2 b.113.1.1 (B:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkki

SCOP Domain Coordinates for d1kfvb2:

Click to download the PDB-style file with coordinates for d1kfvb2.
(The format of our PDB-style files is described here.)

Timeline for d1kfvb2: