SCOP 1.67: Domain d1kfvb2: 1kfv B:1-131

Lineage for d1kfvb2 (1kfv B:1-131)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (2 proteins)

6. Protein DNA repair protein MutM (Fpg) [81621] (4 species)

7. Species Lactococcus lactis [TaxId:1358] [81617] (2 PDB entries)

8. Domain d1kfvb2: 1kfv B:1-131 [75890]
   Other proteins in same PDB: d1kfva1, d1kfva3, d1kfvb1, d1kfvb3
   complexed with cry, mse, pdi, zn; mutant

Details for d1kfvb2

PDB Entry: 1kfv, 2.55 Å

PDB Description: crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna.

SCOP Domain Sequences for d1kfvb2:

Sequence; same for both SEQRES and ATOM records:

>d1kfvb2 b.113.1.1 (B:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkki

Timeline for d1kfvb2:

• d1kfvb2 first appeared in SCOP 1.63
  
• d1kfvb2 appears in SCOP 1.65
  
• d1kfvb2 appears in SCOP 1.69
  
• d1kfvb2 appears in the current release, SCOPe 2.08