Lineage for d1kfvb1 (1kfv B:132-217)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779264Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 779265Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 779340Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 779341Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 779357Species Lactococcus lactis [TaxId:1358] [81615] (7 PDB entries)
    Uniprot P42371
  8. 779365Domain d1kfvb1: 1kfv B:132-217 [75889]
    Other proteins in same PDB: d1kfva2, d1kfva3, d1kfvb2, d1kfvb3
    complexed with cry, mse, pdi, zn; mutant

Details for d1kfvb1

PDB Entry: 1kfv (more details), 2.55 Å

PDB Description: crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna.
PDB Compounds: (B:) Formamido-pyrimidine DNA glycosylase

SCOP Domain Sequences for d1kfvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfvb1 a.156.1.2 (B:132-217) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggs

SCOP Domain Coordinates for d1kfvb1:

Click to download the PDB-style file with coordinates for d1kfvb1.
(The format of our PDB-style files is described here.)

Timeline for d1kfvb1: