SCOP 1.69: Domain d1kfvb1: 1kfv B:132-217

Lineage for d1kfvb1 (1kfv B:132-217)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein DNA repair protein MutM (Fpg) [81620] (4 species)

7. Species Lactococcus lactis [TaxId:1358] [81615] (6 PDB entries)

8. Domain d1kfvb1: 1kfv B:132-217 [75889]
   Other proteins in same PDB: d1kfva2, d1kfva3, d1kfvb2, d1kfvb3

Details for d1kfvb1

PDB Entry: 1kfv, 2.55 Å

PDB Description: crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna.

SCOP Domain Sequences for d1kfvb1:

Sequence; same for both SEQRES and ATOM records:

>d1kfvb1 a.156.1.2 (B:132-217) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggs

Timeline for d1kfvb1:

• d1kfvb1 first appeared in SCOP 1.63
  
• d1kfvb1 appears in SCOP 1.67
  
• d1kfvb1 appears in SCOP 1.71
  
• d1kfvb1 appears in the current release, SCOPe 2.08