Class a: All alpha proteins [46456] (202 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (2 proteins) contains 4 helices in the core |
Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
Species Lactococcus lactis [TaxId:1358] [81615] (2 PDB entries) |
Domain d1kfvb1: 1kfv B:132-217 [75889] Other proteins in same PDB: d1kfva2, d1kfva3, d1kfvb2, d1kfvb3 complexed with cry, mse, pdi, zn; mutant |
PDB Entry: 1kfv (more details), 2.55 Å
SCOP Domain Sequences for d1kfvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfvb1 a.156.1.2 (B:132-217) DNA repair protein MutM (Fpg) {Lactococcus lactis} gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq liessihllhdsiieilqkaiklggs
Timeline for d1kfvb1: