Lineage for d1kfva3 (1kfv A:227-271)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892773Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 892774Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 892790Species Lactococcus lactis [TaxId:1358] [81619] (7 PDB entries)
    Uniprot P42371
  8. 892797Domain d1kfva3: 1kfv A:227-271 [75888]
    Other proteins in same PDB: d1kfva1, d1kfva2, d1kfvb1, d1kfvb2

Details for d1kfva3

PDB Entry: 1kfv (more details), 2.55 Å

PDB Description: crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna.
PDB Compounds: (A:) Formamido-pyrimidine DNA glycosylase

SCOP Domain Sequences for d1kfva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfva3 g.39.1.8 (A:227-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
stgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk

SCOP Domain Coordinates for d1kfva3:

Click to download the PDB-style file with coordinates for d1kfva3.
(The format of our PDB-style files is described here.)

Timeline for d1kfva3: