![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (2 proteins) |
![]() | Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
![]() | Species Lactococcus lactis [TaxId:1358] [81615] (2 PDB entries) |
![]() | Domain d1kfva1: 1kfv A:132-219 [75886] Other proteins in same PDB: d1kfva2, d1kfva3, d1kfvb2, d1kfvb3 |
PDB Entry: 1kfv (more details), 2.55 Å
SCOP Domain Sequences for d1kfva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfva1 a.156.1.2 (A:132-219) DNA repair protein MutM (Fpg) {Lactococcus lactis} gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq liessihllhdsiieilqkaiklggssi
Timeline for d1kfva1: