Lineage for d1keja3 (1kej A:243-302)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001966Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2001967Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2002196Protein Terminal deoxynucleotidyl transferase [81583] (1 species)
  7. 2002197Species Mouse (Mus musculus) [TaxId:10090] [81582] (3 PDB entries)
  8. 2002200Domain d1keja3: 1kej A:243-302 [75884]
    Other proteins in same PDB: d1keja1, d1keja4
    complexed with co, dad, na

Details for d1keja3

PDB Entry: 1kej (more details), 3 Å

PDB Description: Crystal Structure of Murine Terminal Deoxynucleotidyl Transferase complexed with ddATP
PDB Compounds: (A:) Terminal deoxynucleotidyltransferase short isoform

SCOPe Domain Sequences for d1keja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keja3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

SCOPe Domain Coordinates for d1keja3:

Click to download the PDB-style file with coordinates for d1keja3.
(The format of our PDB-style files is described here.)

Timeline for d1keja3: