![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
![]() | Protein Terminal deoxynucleotidyl transferase [81583] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [81582] (3 PDB entries) |
![]() | Domain d1keja3: 1kej A:243-302 [75884] Other proteins in same PDB: d1keja1, d1keja4 complexed with co, dad, na |
PDB Entry: 1kej (more details), 3 Å
SCOPe Domain Sequences for d1keja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1keja3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc
Timeline for d1keja3: