Lineage for d1kdha3 (1kdh A:243-302)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214550Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 214859Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 214860Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
    topological similarity to the N-terminal domain
  6. 214976Protein Terminal deoxynucleotidyl transferase [81583] (1 species)
  7. 214977Species Mouse (Mus musculus) [TaxId:10090] [81582] (3 PDB entries)
  8. 214979Domain d1kdha3: 1kdh A:243-302 [75882]
    Other proteins in same PDB: d1kdha1, d1kdha4
    complexed with bro, mg, na

Details for d1kdha3

PDB Entry: 1kdh (more details), 3 Å

PDB Description: binary complex of murine terminal deoxynucleotidyl transferase with a primer single stranded dna

SCOP Domain Sequences for d1kdha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdha3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus)}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

SCOP Domain Coordinates for d1kdha3:

Click to download the PDB-style file with coordinates for d1kdha3.
(The format of our PDB-style files is described here.)

Timeline for d1kdha3: