Lineage for d1kanb1 (1kan B:126-253)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313855Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) (S)
  5. 2313856Family a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81592] (2 proteins)
    N-terminal catalytic domain is followed by an all-alpha domain
    automatically mapped to Pfam PF07827
  6. 2313857Protein Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81591] (1 species)
  7. 2313858Species Staphylococcus aureus [TaxId:1280] [81590] (2 PDB entries)
  8. 2313862Domain d1kanb1: 1kan B:126-253 [75880]
    Other proteins in same PDB: d1kana2, d1kanb2
    CA-atoms only, mutant protein sequence

Details for d1kanb1

PDB Entry: 1kan (more details), 3 Å

PDB Description: molecular structure of kanamycin nucleotidyltransferase determined to 3.0-angstroms resolution
PDB Compounds: (B:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d1kanb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kanb1 a.24.16.1 (B:126-253) Kanamycin nucleotidyltransferase (KNTase), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
veaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhhricy
ttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterhgyiv
dvskripf

SCOPe Domain Coordinates for d1kanb1:

Click to download the PDB-style file with coordinates for d1kanb1.
(The format of our PDB-style files is described here.)

Timeline for d1kanb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kanb2