Lineage for d1k82c3 (1k82 C:225-268)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640696Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 2640697Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 2640722Species Escherichia coli [TaxId:562] [81618] (1 PDB entry)
  8. 2640725Domain d1k82c3: 1k82 C:225-268 [75874]
    Other proteins in same PDB: d1k82a1, d1k82a2, d1k82b1, d1k82b2, d1k82c1, d1k82c2, d1k82d1, d1k82d2
    covalently trapped with DNA
    protein/DNA complex; complexed with zn

Details for d1k82c3

PDB Entry: 1k82 (more details), 2.1 Å

PDB Description: Crystal structure of E.coli formamidopyrimidine-DNA glycosylase (Fpg) covalently trapped with DNA
PDB Compounds: (C:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1k82c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k82c3 g.39.1.8 (C:225-268) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]}
kpgyfaqelqvygrkgepcrvcgtpivatkhaqratfycrqcqk

SCOPe Domain Coordinates for d1k82c3:

Click to download the PDB-style file with coordinates for d1k82c3.
(The format of our PDB-style files is described here.)

Timeline for d1k82c3: