Class b: All beta proteins [48724] (141 folds) |
Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) |
Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (2 proteins) |
Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
Species Escherichia coli [TaxId:562] [81616] (1 PDB entry) |
Domain d1k82c2: 1k82 C:1-128 [75873] Other proteins in same PDB: d1k82a1, d1k82a3, d1k82b1, d1k82b3, d1k82c1, d1k82c3, d1k82d1, d1k82d3 |
PDB Entry: 1k82 (more details), 2.1 Å
SCOP Domain Sequences for d1k82c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k82c2 b.113.1.1 (C:1-128) DNA repair protein MutM (Fpg) {Escherichia coli} pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele ghnvlthl
Timeline for d1k82c2: