Lineage for d1k82c1 (1k82 C:129-216)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752104Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1752105Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1752180Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 1752181Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 1752206Species Escherichia coli [TaxId:562] [81614] (1 PDB entry)
  8. 1752209Domain d1k82c1: 1k82 C:129-216 [75872]
    Other proteins in same PDB: d1k82a2, d1k82a3, d1k82b2, d1k82b3, d1k82c2, d1k82c3, d1k82d2, d1k82d3
    covalently trapped with DNA
    protein/DNA complex; complexed with zn

Details for d1k82c1

PDB Entry: 1k82 (more details), 2.1 Å

PDB Description: Crystal structure of E.coli formamidopyrimidine-DNA glycosylase (Fpg) covalently trapped with DNA
PDB Compounds: (C:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1k82c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k82c1 a.156.1.2 (C:129-216) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]}
gpeplsddfngeylhqkcakkktaikpwlmdnklvvgvgniyaseslfaagihpdrlass
lslaecellarvikavllrsieqggttl

SCOPe Domain Coordinates for d1k82c1:

Click to download the PDB-style file with coordinates for d1k82c1.
(The format of our PDB-style files is described here.)

Timeline for d1k82c1: