SCOPe 2.07: Domain d1k82b3: 1k82 B:225-268

Lineage for d1k82b3 (1k82 B:225-268)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)

6. Protein DNA repair protein MutM (Fpg) [81622] (4 species)

7. Species Escherichia coli [TaxId:562] [81618] (1 PDB entry)

8. Domain d1k82b3: 1k82 B:225-268 [75871]
   Other proteins in same PDB: d1k82a1, d1k82a2, d1k82b1, d1k82b2, d1k82c1, d1k82c2, d1k82d1, d1k82d2
   covalently trapped with DNA
   protein/DNA complex; complexed with zn

Details for d1k82b3

PDB Entry: 1k82, 2.1 Å

PDB Description: Crystal structure of E.coli formamidopyrimidine-DNA glycosylase (Fpg) covalently trapped with DNA

PDB Compounds: (B:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1k82b3:

Sequence; same for both SEQRES and ATOM records:

>d1k82b3 g.39.1.8 (B:225-268) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]}
kpgyfaqelqvygrkgepcrvcgtpivatkhaqratfycrqcqk

Timeline for d1k82b3:

• d1k82b3 first appeared in SCOP 1.63
  
• d1k82b3 appears in SCOPe 2.06
  
• d1k82b3 appears in the current release, SCOPe 2.08