Class g: Small proteins [56992] (85 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
Species Escherichia coli [TaxId:562] [81618] (1 PDB entry) |
Domain d1k82b3: 1k82 B:225-268 [75871] Other proteins in same PDB: d1k82a1, d1k82a2, d1k82b1, d1k82b2, d1k82c1, d1k82c2, d1k82d1, d1k82d2 |
PDB Entry: 1k82 (more details), 2.1 Å
SCOP Domain Sequences for d1k82b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k82b3 g.39.1.8 (B:225-268) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]} kpgyfaqelqvygrkgepcrvcgtpivatkhaqratfycrqcqk
Timeline for d1k82b3: