Lineage for d1k82a2 (1k82 A:1-128)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430477Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2430478Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) (S)
    automatically mapped to Pfam PF01149
  5. 2430479Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2430480Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 2430505Species Escherichia coli [TaxId:562] [81616] (1 PDB entry)
  8. 2430506Domain d1k82a2: 1k82 A:1-128 [75867]
    Other proteins in same PDB: d1k82a1, d1k82a3, d1k82b1, d1k82b3, d1k82c1, d1k82c3, d1k82d1, d1k82d3
    covalently trapped with DNA
    protein/DNA complex; complexed with zn

Details for d1k82a2

PDB Entry: 1k82 (more details), 2.1 Å

PDB Description: Crystal structure of E.coli formamidopyrimidine-DNA glycosylase (Fpg) covalently trapped with DNA
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1k82a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k82a2 b.113.1.1 (A:1-128) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]}
pelpevetsrrgiephlvgatilhavvrngrlrwpvseeiyrlsdqpvlsvqrrakylll
elpegwiiihlgmsgslrilpeelppekhdhvdlvmsngkvlrytdprrfgawlwtkele
ghnvlthl

SCOPe Domain Coordinates for d1k82a2:

Click to download the PDB-style file with coordinates for d1k82a2.
(The format of our PDB-style files is described here.)

Timeline for d1k82a2: