Lineage for d1jn3a1 (1jn3 A:91-148)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282595Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 282596Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
    topological similarity to the N-terminal domain
  6. 282597Protein DNA polymerase beta [81579] (2 species)
  7. 282691Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)
  8. 282692Domain d1jn3a1: 1jn3 A:91-148 [75864]
    Other proteins in same PDB: d1jn3a2
    mutant

Details for d1jn3a1

PDB Entry: 1jn3 (more details), 2.35 Å

PDB Description: fidelity properties and structure of m282l mutator mutant of dna polymerase: subtle structural changes influence the mechanism of nucleotide discrimination

SCOP Domain Sequences for d1jn3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn3a1 a.60.12.1 (A:91-148) DNA polymerase beta {Rat (Rattus norvegicus)}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOP Domain Coordinates for d1jn3a1:

Click to download the PDB-style file with coordinates for d1jn3a1.
(The format of our PDB-style files is described here.)

Timeline for d1jn3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jn3a2