SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jmsa3 (1jms A:243-302)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999483Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1999484Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 protein domains)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1999713Protein Terminal deoxynucleotidyl transferase [81583] (1 species)
  7. 1999714Species Mouse (Mus musculus) [TaxId:10090] [81582] (3 PDB entries)
  8. 1999715Domain d1jmsa3: 1jms A:243-302 [75862]
    Other proteins in same PDB: d1jmsa1, d1jmsa4
    complexed with mg, na

Details for d1jmsa3

PDB Entry: 1jms (more details), 2.36 Å

PDB Description: Crystal Structure of the Catalytic Core of Murine Terminal Deoxynucleotidyl Transferase
PDB Compounds: (A:) terminal deoxynucleotidyltransferase

SCOPe Domain Sequences for d1jmsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

SCOPe Domain Coordinates for d1jmsa3:

Click to download the PDB-style file with coordinates for d1jmsa3.
(The format of our PDB-style files is described here.)

Timeline for d1jmsa3: