![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily) core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains |
![]() | Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) ![]() |
![]() | Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein) |
![]() | Protein Calcium ATPase, transmembrane domain M [81663] (1 species) the N-terminal 40 residues interact with /form a part of transduction domain A |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (6 PDB entries) |
![]() | Domain d1iwob4: 1iwo B:1-124,B:240-343,B:751-994 [75861] Other proteins in same PDB: d1iwoa1, d1iwoa2, d1iwoa3, d1iwob1, d1iwob2, d1iwob3 Structure in the absence of calcium ions |
PDB Entry: 1iwo (more details), 3.1 Å
SCOP Domain Sequences for d1iwob4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwob4 f.33.1.1 (B:1-124,B:240-343,B:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus)} meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg
Timeline for d1iwob4:
![]() Domains from other chains: (mouse over for more information) d1iwoa1, d1iwoa2, d1iwoa3, d1iwoa4 |