Lineage for d1iwob1 (1iwo B:125-239)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 678178Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 678179Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 678180Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 678181Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (9 PDB entries)
  8. 678194Domain d1iwob1: 1iwo B:125-239 [75858]
    Other proteins in same PDB: d1iwoa2, d1iwoa3, d1iwoa4, d1iwob2, d1iwob3, d1iwob4
    Structure in the absence of calcium ions
    complexed with tg1

Details for d1iwob1

PDB Entry: 1iwo (more details), 3.1 Å

PDB Description: Crystal structure of the SR Ca2+-ATPase in the absence of Ca2+
PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOP Domain Sequences for d1iwob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwob1 b.82.7.1 (B:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOP Domain Coordinates for d1iwob1:

Click to download the PDB-style file with coordinates for d1iwob1.
(The format of our PDB-style files is described here.)

Timeline for d1iwob1: