| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; contains large bifurcated beta-sheet covered on both sides with helices and loops |
Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) ![]() |
| Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (2 proteins) |
| Protein Calcium ATPase [81658] (1 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (3 PDB entries) |
| Domain d1iwoa3: 1iwo A:361-599 [75856] Other proteins in same PDB: d1iwoa1, d1iwoa2, d1iwoa4, d1iwob1, d1iwob2, d1iwob4 |
PDB Entry: 1iwo (more details), 3.1 Å
SCOP Domain Sequences for d1iwoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwoa3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus)}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
Timeline for d1iwoa3:
View in 3DDomains from other chains: (mouse over for more information) d1iwob1, d1iwob2, d1iwob3, d1iwob4 |