SCOPe 2.08: Domain d1iwoa3: 1iwo A:361-599

Lineage for d1iwoa3 (1iwo A:361-599)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432

4. Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family)

5. Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)

6. Protein Calcium ATPase [81658] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (42 PDB entries)
   Uniprot P04191

8. Domain d1iwoa3: 1iwo A:361-599 [75856]
   Other proteins in same PDB: d1iwoa1, d1iwoa2, d1iwoa4, d1iwob1, d1iwob2, d1iwob4
   Structure in the absence of calcium ions
   complexed with tg1
   has additional insertions and/or extensions that are not grouped together

Details for d1iwoa3

PDB Entry: 1iwo, 3.1 Å

PDB Description: Crystal structure of the SR Ca2+-ATPase in the absence of Ca2+

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1iwoa3:

Sequence; same for both SEQRES and ATOM records:

>d1iwoa3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

Timeline for d1iwoa3:

• d1iwoa3 first appeared in SCOP 1.63
  
• d1iwoa3 appears in SCOPe 2.07