SCOPe 2.07: Domain d1iwoa2: 1iwo A:344-360,A:600-750

Lineage for d1iwoa2 (1iwo A:344-360,A:600-750)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
   interrupted by a large insertion, domain N

6. Protein Calcium ATPase, catalytic domain P [81655] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (43 PDB entries)
   Uniprot P04191

8. Domain d1iwoa2: 1iwo A:344-360,A:600-750 [75855]
   Other proteins in same PDB: d1iwoa1, d1iwoa3, d1iwoa4, d1iwob1, d1iwob3, d1iwob4
   Structure in the absence of calcium ions
   complexed with tg1

Details for d1iwoa2

PDB Entry: 1iwo, 3.1 Å

PDB Description: Crystal structure of the SR Ca2+-ATPase in the absence of Ca2+

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1iwoa2:

Sequence; same for both SEQRES and ATOM records:

>d1iwoa2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

Timeline for d1iwoa2:

• d1iwoa2 first appeared in SCOP 1.63
  
• d1iwoa2 appears in SCOPe 2.06
  
• d1iwoa2 appears in the current release, SCOPe 2.08