Lineage for d1iwoa1 (1iwo A:125-239)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 471187Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 471188Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 471189Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 471190Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (6 PDB entries)
  8. 471196Domain d1iwoa1: 1iwo A:125-239 [75854]
    Other proteins in same PDB: d1iwoa2, d1iwoa3, d1iwoa4, d1iwob2, d1iwob3, d1iwob4

Details for d1iwoa1

PDB Entry: 1iwo (more details), 3.1 Å

PDB Description: Crystal structure of the SR Ca2+-ATPase in the absence of Ca2+

SCOP Domain Sequences for d1iwoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwoa1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus)}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOP Domain Coordinates for d1iwoa1:

Click to download the PDB-style file with coordinates for d1iwoa1.
(The format of our PDB-style files is described here.)

Timeline for d1iwoa1: