Lineage for d1huob3 (1huo B:92-148)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444633Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 444634Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 444635Protein DNA polymerase beta [81579] (2 species)
  7. 444729Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)
  8. 444736Domain d1huob3: 1huo B:92-148 [75848]
    Other proteins in same PDB: d1huoa1, d1huoa4, d1huob1, d1huob4

Details for d1huob3

PDB Entry: 1huo (more details), 2.6 Å

PDB Description: crystal structure of dna polymerase beta complexed with dna and cr-tmppcp

SCOP Domain Sequences for d1huob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huob3 a.60.12.1 (B:92-148) DNA polymerase beta {Rat (Rattus norvegicus)}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOP Domain Coordinates for d1huob3:

Click to download the PDB-style file with coordinates for d1huob3.
(The format of our PDB-style files is described here.)

Timeline for d1huob3: