| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins) topological similarity to the N-terminal domain |
| Protein DNA polymerase beta [81579] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries) |
| Domain d1huob3: 1huo B:92-148 [75848] Other proteins in same PDB: d1huoa1, d1huoa4, d1huob1, d1huob4 complexed with cr, tte |
PDB Entry: 1huo (more details), 2.6 Å
SCOP Domain Sequences for d1huob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1huob3 a.60.12.1 (B:92-148) DNA polymerase beta {Rat (Rattus norvegicus)}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek
Timeline for d1huob3: