Lineage for d1gaxb5 (1gax B:579-796)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993200Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1993201Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1993202Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 1993246Protein Valyl-tRNA synthetase (ValRS) [47331] (1 species)
    includes additional alpha+beta (sub)domain at the C-terminus
  7. 1993247Species Thermus thermophilus [TaxId:274] [47332] (3 PDB entries)
  8. 1993251Domain d1gaxb5: 1gax B:579-796 [75845]
    Other proteins in same PDB: d1gaxa2, d1gaxa3, d1gaxa4, d1gaxb2, d1gaxb3, d1gaxb4
    protein/RNA complex; complexed with vaa, zn

Details for d1gaxb5

PDB Entry: 1gax (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue
PDB Compounds: (B:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1gaxb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaxb5 a.27.1.1 (B:579-796) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
anklynaarfvllsregfqakedtptladrfmrsrlsrgveeitalyealdlaqaarevy
elvwsefcdwyleaakpalkagnahtlrtleevlavllkllhpmmpfltselyqaltgke
elaleawpepggrdeeaerafealkqavtavralkaeaglppaqevrvylegetapveen
levfrflsradllperpakalvkamprvtarmplegll

SCOPe Domain Coordinates for d1gaxb5:

Click to download the PDB-style file with coordinates for d1gaxb5.
(The format of our PDB-style files is described here.)

Timeline for d1gaxb5: