![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
![]() | Protein Valyl-tRNA synthetase (ValRS) [47331] (1 species) includes additional alpha+beta (sub)domain at the C-terminus |
![]() | Species Thermus thermophilus [TaxId:274] [47332] (3 PDB entries) |
![]() | Domain d1gaxb5: 1gax B:579-796 [75845] Other proteins in same PDB: d1gaxa2, d1gaxa3, d1gaxa4, d1gaxb2, d1gaxb3, d1gaxb4 protein/RNA complex; complexed with vaa, zn |
PDB Entry: 1gax (more details), 2.9 Å
SCOPe Domain Sequences for d1gaxb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gaxb5 a.27.1.1 (B:579-796) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} anklynaarfvllsregfqakedtptladrfmrsrlsrgveeitalyealdlaqaarevy elvwsefcdwyleaakpalkagnahtlrtleevlavllkllhpmmpfltselyqaltgke elaleawpepggrdeeaerafealkqavtavralkaeaglppaqevrvylegetapveen levfrflsradllperpakalvkamprvtarmplegll
Timeline for d1gaxb5:
![]() Domains from other chains: (mouse over for more information) d1gaxa2, d1gaxa3, d1gaxa4, d1gaxa5 |