Lineage for d1fa0b4 (1fa0 B:2-201)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051020Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1051021Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 1051199Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 1051200Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 1051201Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (5 PDB entries)
  8. 1051209Domain d1fa0b4: 1fa0 B:2-201 [75840]
    Other proteins in same PDB: d1fa0a1, d1fa0a3, d1fa0b1, d1fa0b3
    complexed with 3ad, 3at, mn, pop

Details for d1fa0b4

PDB Entry: 1fa0 (more details), 2.6 Å

PDB Description: structure of yeast poly(a) polymerase bound to manganate and 3'-datp
PDB Compounds: (B:) poly(a)-polymerase

SCOPe Domain Sequences for d1fa0b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fa0b4 d.218.1.3 (B:2-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqr
fvyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfd
sllrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnld
ekdlralngtrvtdeilelv

SCOPe Domain Coordinates for d1fa0b4:

Click to download the PDB-style file with coordinates for d1fa0b4.
(The format of our PDB-style files is described here.)

Timeline for d1fa0b4: