Lineage for d1fa0a4 (1fa0 A:3-201)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516107Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 516108Superfamily d.218.1: Nucleotidyltransferase [81301] (9 families) (S)
  5. 516247Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 516248Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 516249Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (1 PDB entry)
  8. 516250Domain d1fa0a4: 1fa0 A:3-201 [75838]
    Other proteins in same PDB: d1fa0a1, d1fa0a3, d1fa0b1, d1fa0b3

Details for d1fa0a4

PDB Entry: 1fa0 (more details), 2.6 Å

PDB Description: structure of yeast poly(a) polymerase bound to manganate and 3'-datp

SCOP Domain Sequences for d1fa0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fa0a4 d.218.1.3 (A:3-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
sqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrf
vyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfds
llrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnlde
kdlralngtrvtdeilelv

SCOP Domain Coordinates for d1fa0a4:

Click to download the PDB-style file with coordinates for d1fa0a4.
(The format of our PDB-style files is described here.)

Timeline for d1fa0a4: