Lineage for d1fa0a3 (1fa0 A:202-351)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450031Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 450032Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (3 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 450033Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)
  6. 450034Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)
  7. 450035Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81628] (1 PDB entry)
  8. 450036Domain d1fa0a3: 1fa0 A:202-351 [75837]
    Other proteins in same PDB: d1fa0a1, d1fa0a4, d1fa0b1, d1fa0b4

Details for d1fa0a3

PDB Entry: 1fa0 (more details), 2.6 Å

PDB Description: structure of yeast poly(a) polymerase bound to manganate and 3'-datp

SCOP Domain Sequences for d1fa0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fa0a3 a.160.1.1 (A:202-351) Poly(A) polymerase, PAP, middle domain {Baker's yeast (Saccharomyces cerevisiae)}
pkpnvfrialraiklwaqrravyanifgfpggvawamlvaricqlypnacsavilnrffi
ilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvitpaypsmcathnitestk
kvilqefvrgvqitndifsnkkswanlfek

SCOP Domain Coordinates for d1fa0a3:

Click to download the PDB-style file with coordinates for d1fa0a3.
(The format of our PDB-style files is described here.)

Timeline for d1fa0a3: